PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g104370.1
Common NameMTR_3g104370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 233aa    MW: 26126.6 Da    PI: 10.5413
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g104370.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-1491136247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+ +++++ ++lG+g+W+ I+r + +++t+ q+ s+ qk+
  Medtr3g104370.1  91 MPWTEEEHMIFLRGLEKLGKGNWRGISRDFVTTKTPTQVASHAQKH 136
                      69******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7485141IPR017930Myb domain
SuperFamilySSF466892.09E-1686141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-1688140IPR006447Myb domain, plants
SMARTSM007171.7E-1089139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1190136IPR009057Homeodomain-like
PfamPF002498.5E-1291136IPR001005SANT/Myb domain
CDDcd001676.98E-1092137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MRIARKCSYC GNFGHNSRTC NNSLKEQFHL YSSSPSYLPT KRSIRKNYLP SSRTSLSIAS  60
SWPTLFGSNE NSDSCVRNWH TSTIRPSKKG MPWTEEEHMI FLRGLEKLGK GNWRGISRDF  120
VTTKTPTQVA SHAQKHFLRQ SQNSLVNRRK HHLSLHNVGC EKPGINLTPN DISCISQLSG  180
SRNFLSQLLS HPQHSMLKWP NSSTSTNCTP HSAAPDLELK LATPMPLEPT SP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.206050.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1419860.0BT141986.1 Medicago truncatula clone JCVI-FLMt-1L13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603145.11e-171MYB-like transcription factor family protein
TrEMBLG7J7M51e-171G7J7M5_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA06G05450.21e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151421013
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.18e-34MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]